PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00155453001
Common NameGSBRNA2T00155453001, LOC106412254
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 297aa    MW: 32824.9 Da    PI: 8.0208
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00155453001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.6e-171461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT+eEde+lv+++k+   g+W+t ++  g+ R++k+c++rw +yl
  GSBRNA2T00155453001 14 KGPWTAEEDEILVEYIKKNSHGSWRTLPKNAGLLRCGKSCRLRWTNYL 61
                         79******************************99************97 PP

2Myb_DNA-binding53.94.2e-1767112148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          rg++T+eE++l v++++ lG++ W++Ia+ ++ gRt++++k+ w+++l
  GSBRNA2T00155453001  67 RGPFTPEEEKLVVQLHAILGNR-WAAIAAQLP-GRTDNEIKNLWNTHL 112
                          89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-23563IPR009057Homeodomain-like
PROSITE profilePS5129416.144961IPR017930Myb domain
SuperFamilySSF466894.87E-3011108IPR009057Homeodomain-like
SMARTSM007177.2E-131363IPR001005SANT/Myb domain
PfamPF002492.7E-141461IPR001005SANT/Myb domain
CDDcd001674.78E-101661No hitNo description
PROSITE profilePS5129426.10262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2664116IPR009057Homeodomain-like
SMARTSM007172.0E-1566114IPR001005SANT/Myb domain
PfamPF002496.7E-1667112IPR001005SANT/Myb domain
CDDcd001677.62E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MGRTPCCDKK GLKKGPWTAE EDEILVEYIK KNSHGSWRTL PKNAGLLRCG KSCRLRWTNY  60
LRPDIKRGPF TPEEEKLVVQ LHAILGNRWA AIAAQLPGRT DNEIKNLWNT HLKKRLLSMG  120
LDPKTHEPLP SFGLAIQAPA SPTTRHMAQW ESARLEAEAR LSRESMLFNP SSAGGGGKTD  180
CDHFLRIWNS QIGESFRNLA PFDETTTSQS PCSRTTTTTT TTSSSSAALP KSSTNSCVGK  240
EIVVKTHHHG SDSYSPCSNN LEDVSSDSAL QLLLDFPISD DDMSFLEENI SSYSKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-29121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00155453001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013708613.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLA0A078C4J60.0A0A078C4J6_BRANA; BnaC08g31190D protein
STRINGBra007588.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69822643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-160myb domain protein 17
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]